Product Certification&
    Enterprise Certification

  • Ms.noa
    manager
    Tel: 86-13131137377

  • Mobile:86-13131137377
  • Tel:86-13131137377
  • Fax:
  • URL:https://en.yan-xi.com/
  • Province/state:hebei
  • City:xingtai
  • Street:Zhang zhe, guangzong county, xingtai city, hebei province
  • MaxCard:
Home > Products >  SERMORELIN

SERMORELIN CAS NO.86168-78-7

  • FOB Price: USD: 500.00-500.00 /Gram Get Latest Price
  • Min.Order: 1000 Gram
  • Payment Terms: L/C,T/T,
  • Available Specifications:

    1(1000-10000)Gram

  • Product Details

Keywords

  • SERMORELIN
  • Sermoreline; Sermorelina; Sermorelinum
  • 86168-78-7

Quick Details

  • ProName: SERMORELIN
  • CasNo: 86168-78-7
  • Molecular Formula: C149H246N44O42S
  • Appearance: appearance White powder
  • Application: Widely used in cosmetics, medicine, be...
  • DeliveryTime: 3day
  • PackAge: 1000 g/aluminum foil bag
  • Port: tianjin china
  • ProductionCapacity: 10 Metric Ton/Month
  • Purity: 99.5(%)
  • Storage: Dry and ventilated
  • Transportation: shipping
  • LimitNum: 1000 Gram
  • Moisture Content: PH (0.1% aqueous solution) : 6.0 ~ 7.5
  • Impurity: Protein: 0.1% or less
  • Light transmittance (0.1% aqueous solution) : 0.1% or greater: Light transmittance (0.1% aqueous solu...

Superiority

chengdu and import and export trade co., LTD., who registered capital of 10 million yuan, nearly  to $2 million, we  have a pharmaceutical raw materials factory production of pharmaceutical raw materials, and a reagent r&d center, and we do research and development production of reagent tens of thousands of species. our aim is quality strives for the survival. Seek development by credit reputation. Our products have big price advantage in Europe South America and so on .and Our company also  has the advantage of high quality in Africa. in the past two years our products  has reached more than 30 countries in the world, Europe. South America. North America, southeast Asia, Africa, etc. We welcome all over the world with the best quality and lowest price friend common cooperation and common development!The quality of our products meet all international standards, the German advanced equipment are imported equipment two laboratories, individual, on scale management concept, our aim is;With the highest quality. The lowest price. The best service to meet the new and old customers around the world, develop together for a better future!

Details

            Keywords

  • Sermorelin
  • sermorelin acetate
  • hGH stimulator

Quick Details

  • ProName: Sermorelin good quality low price
  • CasNo: 86168-78-7
  • Appearance: white powder
  • Application: for research only
  • DeliveryTime: prompt
  • PackAge: aluminum foil bag,bottle, customized
  • Port: Shanghai, HK
  • ProductionCapacity: 100 Gram/Month
  • Purity: 98%
  • Storage: in refridge
  • Transportation: EMS,DHL,FedEx,TNT,HKEMS,HKDHL
  • LimitNum: 1 Gram
  • Related Substances: Sermorelin
  • Residue on Ignition: NA
  • Heavy Metal: NA
  • Valid Period: NA

Superiority

 

1, factory price, top quality guaranteed

2, fast delivery

3, COA/HPLC/HNMR available

4, reliable provider & satisfactory service

 

Details

Product name

Sermorelin

Chemical name

SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN)

CAS NO.

86168-78-7

Formula

C149H246N44O42S

Color

white powder

Application

to be the shortest fully functional fragment of GHRH.[1] It is used as a test for growth hormone secretion

 

1,About Sermorelin

Sermorelin is a growth hormone releasing hormone (GHRH) analogue. It is a 29-amino acid polypeptide representing the 1–29 fragment from endogenous human growth hormone releasing hormone, and is thought to be the shortest fully functional fragment of GHRH.[1] It is used as a test for growth hormone secretion. It is also used as doping substance in sports due to its correlation with increased growth of muscular and skeletal tissue.[3] Sermorelin use is also hypothesized to improve deep rapid eye movement sleep.

Sermorelin is a synthetic hormone that has been proven to aid in raising levels of IGF-1 or Human Growth Hormone levels.

Nearly every adult would like to look and feel younger. Many adults would even like to completely stop the aging process all together. At Male Medical Group we haven't found how to stop time or reverse the aging process (yet), but we do offer a safe and affordable alternative. It is called Sermorelin. As we all know, time goes on and we begin to experience the loss of physical and mental capabilities simply due to the nature of aging. However through modern medicine we are now able to provide the aging male and female an option to look and feel like they are still in their prime.                                                                                                                                                       

 

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog